General Information

  • ID:  hor000225
  • Uniprot ID:  Q26491
  • Protein name:  Ion transport peptide
  • Gene name:  NA
  • Organism:  Schistocerca gregaria (Desert locust) (Gryllus gregarius)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  Brain and corpus cardiacum.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Schistocerca (genus), Cyrtacanthacridinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SFFDIQCKGVYDKSIFARLDRICEDCYNLFREPQLHSLCRSDCFKSPYFKGCLQALLLIDEEEKFNQMVEIL
  • Length:  72
  • Propeptide:  MHHQKQQQQQKQQGEAPCRHLQWRLSGVVLCVLVVASLVSTAASSPLDPHHLAKRSFFDIQCKGVYDKSIFARLDRICEDCYNLFREPQLHSLCRSDCFKSPYFKGCLQALLLIDEEEKFNQMVEILGKK
  • Signal peptide:  NA
  • Modification:  T72 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates salt and water reabsorption and inhibits acid secretion in the ileum of S.gregaria.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-Q26491-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000225_AF2.pdbhor000225_ESM.pdb

Physical Information

Mass: 983153 Formula: C384H589N97O111S7
Absent amino acids: TW Common amino acids: L
pI: 4.72 Basic residues: 10
Polar residues: 18 Hydrophobic residues: 25
Hydrophobicity: -14.44 Boman Index: -12478
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 86.67
Instability Index: 4480.14 Extinction Coefficient cystines: 4845
Absorbance 280nm: 68.24

Literature

  • PubMed ID:  8786332
  • Title:  Locust Ion Transport Peptide (ITP): Primary Structure, cDNA and Expression in a Baculovirus System